TodayBuildContextBrowseMore
stackBETAv0.1
TodayBuild a stackCommon stacksEncyclopediaPulse
Methodology
← Back to your stack
Monograph
PENDING · FEB 2027P-047
Recovery

LL-37 (Cathelicidin)

37-amino acid cathelicidin antimicrobial peptide. Direct membrane disruption against bacteria, fungi, viruses; modulates innate immune signaling.

ExperimentalRecovery
Typical dosevaries — research stage
Frequencyresearch-only
Half-life0.3h
Citations indexed71
DeliveryInjectable
Half-life~18min
EvidenceExperimental
Citations71
Synergy checkCompareReconstitution calc
Experimental

Evidence is experimental. Most claims trace to limited human studies or animal models. Treat as a research direction, not a protocol.

Mechanism

Endogenous human host-defense peptide. Investigated as a topical antimicrobial and adjunct in chronic infections. Vitamin D status correlates with endogenous LL-37 expression. Synthetic supplementation is research-stage; biotech candidates target diabetic foot ulcers and chronic wounds.

Specifics
Slow wound healing
Caveats

Off-target inflammatory effects at high concentration. Most therapeutic value of cathelicidin in real life comes from optimizing vitamin D status, not exogenous LL-37.

sequence · 37 aa
[LL-37, 37 aa]
Evidence levelExperimental
Regulatory statusFDA Cat. 2 removed Apr 2026 — PCAC review Feb 2027
DNA / pharmacogenomicsModerate — CAMP gene variants modulate endogenous expression; vitamin D status is a stronger lever in practice.
Pairs & ConflictsCheck full stack →
Synergizes with

Mechanistically distinct — hits a different pathway.

TA-1
Claims & evidence

Per-claim grading. Each claim is graded independently — same peptide, different claims can carry different grades.

  • DMechanistic / anecdotal

    LL-37 (Cathelicidin) — primary mechanism: 37-amino acid cathelicidin antimicrobial peptide. direct membrane disruption against bacteria, fungi, viruses; modulates innate immune signaling.

    1 supporting referencesVerified 5d ago
References

External links to PubMed searches, ClinicalTrials.gov, and FDA materials. We do not host papers — we point at canonical sources.

  • PubMedEN
    REVIEWFunding undisclosedVerified 5d ago
    PubMed — LL-37 cathelicidin
Reconstitution calculatorLL-37

Pre-filled with this compound's published dose range: varies — research stage · research-only

Concentration2.50 mg/mL
Draw volume0.100 mL
Insulin syringe10.0 u
Doses per vial20
U-100 syringe — fill to indicatorU-100 · 1 mL
0u25u50u75u100u

Calculator is a discussion tool. Verify reconstitution + dosing with a qualified provider. Stack is not a prescription source. Use sterile technique and inspect every vial.

PENDING · FEB 2027P-047

FDA Cat. 2 removed Apr 2026 — PCAC review Feb 2027

Feb 15, 2027USScheduled reviewUpcoming

PCAC review · February 2027 panel

FDA's Pharmacy Compounding Advisory Committee scheduled to review the second cohort of peptides removed from Category 2 in April 2026. Panel votes whether to add each to the official 503A bulks list.

Apr 15, 2026USTier change

FDA removes 12 peptides from Category 2 'significant safety concerns' list

FDA published a Federal Register notice on April 15 2026 removing 12 peptides from the Category 2 ('significant safety concerns') compounding list, paving the way for PCAC review for inclusion on the 503A bulks list. Peptides removed: BPC-157, TB-500, Epitalon, GHK-Cu (injectable), MOTS-c, DSIP, Dihexa Acetate, MK-677, Melanotan II, KPV, Semax, LL-37.

FDA Federal Register · April 15 2026 →
Nov 2023USBan

FDA places peptides on Category 2 'significant safety concerns' list

FDA's Pharmacy Compounding Advisory Committee categorized a wide list of peptides as Category 2 ('significant safety concerns'), effectively banning their compounding at 503A and 503B pharmacies. Affected: BPC-157, TB-500, Epitalon, GHK-Cu, MOTS-c, DSIP, Dihexa, MK-677, Melanotan II, KPV, Semax, Selank, LL-37 and others.

LL-37varies — research stage · research-only
Discussion guide, not prescription

stack is an exploration engine. Output is a discussion guide for a conversation with a licensed provider — never a prescription, dose recommendation, or sourcing instruction. Peptides discussed include compounds with limited human evidence and varying legal status by jurisdiction. Verify everything with a qualified clinician before any decision.

Full terms →
stackv0.1
AudiencesWho Stack is forFor researchersFor pharmaciesFor cliniciansFor press
Trust & regulatoryCalibrationMethodologyFDA statusPharmacy registryPCAC commentMX · COFEPRIS
Built honest. Bilingual from day one.