TodayBuildContextBrowseMore
stackBETAv0.1
TodayBuild a stackCommon stacksEncyclopediaPulse
Methodology
← Back to your stack
Monograph
FDA APPROVEDP-041
Metabolic

Liraglutide

Long-acting GLP-1 receptor agonist. Daily injection. Predecessor to semaglutide in the Novo Nordisk GLP-1 lineage.

EstablishedMetabolic
Typical dose0.6-3 mg
Frequencydaily, subcutaneous
Half-life13h
Citations indexed287
DeliveryInjectable
Half-life~13h
EvidenceEstablished
Citations287
Synergy checkCompareReconstitution calc
Mechanism

FDA-approved as Saxenda (obesity) and Victoza (T2D). Demonstrates 5-8% weight reduction at 56 weeks in SCALE trials — superseded by semaglutide and tirzepatide for newer use, but remains a covered option for many insurance formularies.

Specifics
Weight / fat lossAppetite controlInsulin sensitivity
Caveats

Daily injection burden vs. weekly semaglutide is real. Same pancreatitis / gallbladder watch. Often used now as bridge while waiting for semaglutide / tirzepatide insurance approval.

sequence · 31 aa
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

C16 palmitoyl group conjugated at K20 via γ-glutamic acid spacer.

Evidence levelEstablished
Regulatory statusFDA approved (Saxenda / Victoza)
DNA / pharmacogenomicsDocumented — Same GLP1R variant context as semaglutide.
Pairs & ConflictsCheck full stack →
Avoid stacking

Known risk or pharmacological conflict.

TirzepatideSemaglutideRetatrutideDulaglutideExenatide
Where the experts disagree

Stack doesn't rank peptides — we surface the diversity of opinion. Each card paraphrases a public-record stance from a named source. Where they conflict is where you should slow down and read both.

RCT / meta-analysisNovo Nordisk SCALE program — Phase 3, 2014-2020

Liraglutide (Saxenda for obesity, Victoza for T2D) was the first GLP-1 agonist approved for weight management. SCALE trials showed ~5-8% body-weight reduction at 56 weeks — modest by Tirzepatide / Semaglutide standards but meaningful pre-2017. Daily injection, less convenient than weekly Sema/Tirz. Generic versions filing post-2024 patent expiry.

ClinicianPractical obesity-medicine consensus, 2024-2026

Liraglutide remains useful when insurance won't cover Wegovy/Zepbound or when patients can't tolerate weekly dosing. With generics arriving, cash-pay cost drops materially. Daily injection is the friction point most users dislike — adherence drops noticeably vs weekly options.

Claims & evidence

Per-claim grading. Each claim is graded independently — same peptide, different claims can carry different grades.

  • BModerate evidence

    Liraglutide — primary mechanism: long-acting glp-1 receptor agonist. daily injection. predecessor to semaglutide in the novo nordisk glp-1 lineage.

    2 supporting referencesVerified 5d ago
References

External links to PubMed searches, ClinicalTrials.gov, and FDA materials. We do not host papers — we point at canonical sources.

  • RegulatoryEN
    REGULATORYFunding undisclosedVerified 5d ago
    FDA Saxenda label
  • ReviewES
    REVIEWFunding undisclosedVerified 5d ago
    SciELO — liraglutida
Reconstitution calculatorLiraglutide

Pre-filled with this compound's published dose range: 0.6-3 mg · daily, subcutaneous

Concentration2.50 mg/mL
Draw volume0.720 mL
Insulin syringe72.0 u
Doses per vial2
U-100 syringe — fill to indicatorU-100 · 1 mL
0u25u50u75u100u

Calculator is a discussion tool. Verify reconstitution + dosing with a qualified provider. Stack is not a prescription source. Use sterile technique and inspect every vial.

First cycle costCheapest legal from $120

How much a first cycle actually costs across the channels people use. Pick the protocol length you're considering — Stack multiplies the monthly band by cycle weeks. Same caveats apply: ranges are facts, quality varies, this is not legal advice.

MX pharmacy (brand)$120–$280
FDA-approved brand$400–$1400

Numbers reflect publicly-advertised price ranges, not vendor quotes. Insurance, prescription costs, and shipping aren't included. Channels marked unavailable are filtered out.

See pharmacies for this compound →
Price across channelsRange $120–$1400/mo

Approximate monthly cost across the channels users actually consider — brand FDA-approved retail, US 503A compounding, Mexican pharmacies, MX farmacias magistrales, and the research-grey market. Stack lists ranges, not vendor names. Quality varies wildly across channels — see each band's note.

FDA-approved brand$400–$1400/mo

Saxenda (obesity) and Victoza (T2D). Generics filed; pricing dropping. Daily injection, less convenient than weekly Sema/Tirz.

As of 2026-04
MX pharmacy (brand)$120–$280/mo

Saxenda + Victoza available COFEPRIS-registered MX pharmacies.

As of 2026-04
FDA APPROVEDP-041

FDA approved (Saxenda / Victoza)

Aug 2024MXGuidance

COFEPRIS issues counterfeit-Ozempic warning amid cross-border GLP-1 demand

COFEPRIS issued formal warnings about counterfeit Ozempic, Wegovy, and Saxenda circulating in Mexican gray markets, particularly in border-state pharmacies catering to US cross-border traffic. Several seizures documented in Tijuana, Juárez, and Reynosa.

2024MXGuidance

Mexico (COFEPRIS) maintains GLP-1 prescription regime through obesity epidemic

COFEPRIS (Mexican federal health regulator) continued to require physician prescription for GLP-1 agonists through 2023-2024 despite high obesity prevalence and pharmacy-tourism demand from US patients. Compounding less restrictive than US 503A regime.

Liraglutide0.6-3 mg · daily, subcutaneous
Discussion guide, not prescription

stack is an exploration engine. Output is a discussion guide for a conversation with a licensed provider — never a prescription, dose recommendation, or sourcing instruction. Peptides discussed include compounds with limited human evidence and varying legal status by jurisdiction. Verify everything with a qualified clinician before any decision.

Full terms →
stackv0.1
AudiencesWho Stack is forFor researchersFor pharmaciesFor cliniciansFor press
Trust & regulatoryCalibrationMethodologyFDA statusPharmacy registryPCAC commentMX · COFEPRIS
Built honest. Bilingual from day one.